PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa09g077920.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HD-ZIP
Protein Properties Length: 730aa    MW: 79506.7 Da    PI: 7.0095
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa09g077920.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.81e-193388156
                    TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                    +++ +++t++q+++Le+ F+++++p++++r +L+++lgL  rq+k+WFqNrR++ k
  Csa09g077920.1 33 KKRYHRHTAQQIQRLESSFKECPHPDEKQRNQLSRELGLAPRQIKFWFQNRRTQLK 88
                    688999**********************************************9877 PP

2START124.91e-392374602206
                     HHHHHHHHHHHHHHHC-TT-EEEE...EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGG...CT-TT-SEEEEEEE CS
           START   2 laeeaaqelvkkalaeepgWvkss...esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddke...qWdetlakaetlev 84 
                     +a++a++el+++   +ep+W+k     +++n   +  +f++s +      +++ea+r sg+v+m+++ lv  ++d  +    +   +a+ +tl+v
  Csa09g077920.1 237 IALTAMEELLRLLHTNEPLWTKTDgsrDILNLGSYENIFPRSSNrgknhnFRVEASRSSGIVFMNAMALVDMFMDCVKcaeLFPSIIAASKTLAV 331
                     6899******************99999*************999999****************************99988889999999******* PP

                     ECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCE....EEEEEEE CS
           START  85 issg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksngh....skvtwve 168
                     iss       gal+l + e+ +lsplv+ R+   +Ry++q ++g+wv+v vS d +q+++ +s++ R   +pSg+li++++ng+    + ++ + 
  Csa09g077920.1 332 ISSRmggtheGALHLLYEEMEVLSPLVAtREICELRYCQQIEQGSWVVVNVSYDLPQFVS-HSQSFR---FPSGCLIQDMPNGYskvnTSFFLIP 422
                     ***999******************************************************.9****9...**************88888889*** PP

                     -EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 169 hvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                     +v lk+  +h+l+r +++ g+a+ga +w+ tlqr ce+
  Csa09g077920.1 423 SVLLKKEPIHELYREMIHDGIAFGAERWLTTLQRMCER 460
                     ************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.18E-201490IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.6E-221984IPR009057Homeodomain-like
PROSITE profilePS5007118.1553090IPR001356Homeobox domain
SMARTSM003891.6E-183194IPR001356Homeobox domain
CDDcd000863.56E-193391No hitNo description
PfamPF000463.1E-173388IPR001356Homeobox domain
PROSITE patternPS0002706588IPR017970Homeobox, conserved site
PROSITE profilePS5084838.448227463IPR002913START domain
SuperFamilySSF559611.1E-25228462No hitNo description
CDDcd088751.30E-89231459No hitNo description
SMARTSM002343.2E-28236460IPR002913START domain
PfamPF018522.4E-32237460IPR002913START domain
Gene3DG3DSA:3.30.530.207.7E-5284415IPR023393START-like domain
SuperFamilySSF559615.93E-20481717No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 730 aa     Download sequence    Send to blast
MSFVVGVGGS GSGSGGDGGG SQHHDGSETD RKKKRYHRHT AQQIQRLESS FKECPHPDEK  60
QRNQLSRELG LAPRQIKFWF QNRRTQLKAQ HERADNSALK AENDKIRCEN IAIREALKHA  120
ICPNCGGPPV SEDPYFDEQK LRIENAHLRE ELERMSTIAS KYMGRPISQL STLHPMHISP  180
LDLSMTSLTG CGPCGHGPSL DFDLLPGSSM SVSGHNNLQS QPNLAISDMD KPLMTGIALT  240
AMEELLRLLH TNEPLWTKTD GSRDILNLGS YENIFPRSSN RGKNHNFRVE ASRSSGIVFM  300
NAMALVDMFM DCVKCAELFP SIIAASKTLA VISSRMGGTH EGALHLLYEE MEVLSPLVAT  360
REICELRYCQ QIEQGSWVVV NVSYDLPQFV SHSQSFRFPS GCLIQDMPNG YSKVNTSFFL  420
IPSVLLKKEP IHELYREMIH DGIAFGAERW LTTLQRMCER FASLSVPASS SRDLGGVIPS  480
PEGKRSMMRL AQRMISNYCL SVSRSNNTRS TVVSELNEVG VRVTAHKSPE PNGTVLCAAT  540
TFWLPNSPQN VFNFLKDERT RPQWDVLSNG NSVQEVAHIS NGSHPGNCIS VLRASNASQS  600
NNMLILQESS TDSSGALVVY SPVDLSALNI AMSGEDPSYI PLLSSGFAIS PDGNGSTSEQ  660
GGGASTSSGR SSSSNSSGSL ITVGFQIMVS NLPSAKLNME SVETVNNLIG TTVHQIKTAL  720
SGPTASTTA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0039790.0BT003979.1 Arabidopsis thaliana clone RAFL15-10-L20 (R20587) putative homeobox protein (At1g73360) mRNA, complete cds.
GenBankBT0049150.0BT004915.1 Arabidopsis thaliana clone U20587 putative homeobox protein (At1g73360) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010428260.10.0PREDICTED: homeobox-leucine zipper protein HDG11
SwissprotQ9FX310.0HDG11_ARATH; Homeobox-leucine zipper protein HDG11
TrEMBLR0I7H50.0R0I7H5_9BRAS; Uncharacterized protein
STRINGAT1G73360.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30042665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.10.0homeodomain GLABROUS 11